Product browse


New Distributor

Israel, Egypt, Turkey and other Middle East Countries BioTAG Ltd Read more


Most of customers' orders are now dispatched directly from USA and EuropeRead more

Insulin Polyclonal Antibody

Catalog No.:AB0159-200

Price / Unit: EUR 320.00

Source: Goat

Quantity/unit size: 600 µg

Description: Goat polyclonal to Insulin. Insulin is a 6 kDa peptide, first synthesized as a precursor molecule, preproinsulin which is then processed into proinsulin and finally to the mature insulin.  An increase in blood glucose levels during stimulates insulin release from pancreatic ? cells. Binding of insulin to the insulin receptor (INSR) stimulates glucose uptake.

Alternative names: IDDM, IDDM1, IDDM2, ILPR, IRDN, MODY10 antibody.

Form: Polyclonal antibody supplied as a 200 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.

Immunogen: Recombinant human Insulin (MFVNQHLCGSHLVEALYLVCGERGFFYTPKTGIVEQCCTSICSLYQLENYCN) produced in E. coli as a fusion protein.

Specificity: Gives a positive signal using MBP-Insulin recombinant fusion protein by WB.

Reactivity: Reacts against human, rat, mouse, canine and monkey proteins.

Usage: Western blot                        1:250-1:2,000
Immunofluorescence                                 ND
Immunohistochemistry (paraffin)               ND
Immunohistochemistry (frozen)                 ND

Reactivity chart

Sample Western Blot Immuno-fluorescence Immuno-Histochemistry (p) Immuno-Histochemistry (f)
human +++ ND ND ND
rat +++ ND ND ND
mouse +++ ND ND ND
canine +++ ND ND ND
monkey +++ ND ND ND

Storage: Store at -20 C for long-term storage. Store at 2-8 C for up to one month.

Special instructions: Avoid freeze/thaw cycles.


For research use only, not for diagnostic use