Insulin Polyclonal Antibody

Catalog No.:AB0159-200

Price / Unit: EUR 320.00

Source: Goat

Quantity/unit size: 600 µg

Description: Goat polyclonal to Insulin. Insulin is a 6 kDa peptide, first synthesized as a precursor molecule, preproinsulin which is then processed into proinsulin and finally to the mature insulin.  An increase in blood glucose levels during stimulates insulin release from pancreatic ? cells. Binding of insulin to the insulin receptor (INSR) stimulates glucose uptake.

Alternative names: IDDM, IDDM1, IDDM2, ILPR, IRDN, MODY10 antibody.

Form: Polyclonal antibody supplied as a 200 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.

Immunogen: Recombinant human Insulin (MFVNQHLCGSHLVEALYLVCGERGFFYTPKTGIVEQCCTSICSLYQLENYCN) produced in E. coli as a fusion protein.

Specificity: Gives a positive signal using MBP-Insulin recombinant fusion protein by WB.

Reactivity: Reacts against human, rat, mouse, canine and monkey proteins.

Usage: Western blot                        1:250-1:2,000
Immunofluorescence                                 ND
Immunohistochemistry (paraffin)               ND
Immunohistochemistry (frozen)                 ND

Reactivity chart

Sample Western Blot Immuno-fluorescence Immuno-Histochemistry (p) Immuno-Histochemistry (f)
human +++ ND ND ND
rat +++ ND ND ND
mouse +++ ND ND ND
canine +++ ND ND ND
monkey +++ ND ND ND

Storage: Store at -20 C for long-term storage. Store at 2-8 C for up to one month.

Special instructions: Avoid freeze/thaw cycles.

References



For research use only, not for diagnostic use